Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGL2 protein

This Human FGL2 protein spans the amino acid sequence from region 24-439aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen-like protein 2 pT49

UniProt

Q14314

Expression Region

24-439aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ACBD4 Protein, His-SUMO, E.coli-500ug
QP7825-ec-500ug 500ug

Recombinant Human ACBD4 Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
Human Exoribonuclease 3 (ERI3) ELISA Kit
MBS9301762-01 48 Well

Human Exoribonuclease 3 (ERI3) ELISA Kit

Sign In for Pricing
View Details
Human Exoribonuclease 3 (ERI3) ELISA Kit
MBS9301762-02 96 Well

Human Exoribonuclease 3 (ERI3) ELISA Kit

Sign In for Pricing
View Details
Human Exoribonuclease 3 (ERI3) ELISA Kit
MBS9301762-03 5x 96 Well

Human Exoribonuclease 3 (ERI3) ELISA Kit

Sign In for Pricing
View Details
Human Exoribonuclease 3 (ERI3) ELISA Kit
MBS9301762-04 10x 96 Well

Human Exoribonuclease 3 (ERI3) ELISA Kit

Sign In for Pricing
View Details
SEMA5A siRNA Oligos set (Human)
43355171 3x 5 nmol

SEMA5A siRNA Oligos set (Human)

Sign In for Pricing
View Details