Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SCRG1 protein

This Human SCRG1 protein spans the amino acid sequence from region 21-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein Short name, ScRG-1

UniProt

O75711

Expression Region

21-98aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NHLRC1 Protein Vector (Human) (pPB-N-His)
PV055538 500 ng

NHLRC1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Neurofibromin 2 (NF2)
MBS2060890-01 0.1 mL

PE-Linked Polyclonal Antibody to Neurofibromin 2 (NF2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Neurofibromin 2 (NF2)
MBS2060890-02 0.2 mL

PE-Linked Polyclonal Antibody to Neurofibromin 2 (NF2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Neurofibromin 2 (NF2)
MBS2060890-03 0.5 mL

PE-Linked Polyclonal Antibody to Neurofibromin 2 (NF2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Neurofibromin 2 (NF2)
MBS2060890-04 1 mL

PE-Linked Polyclonal Antibody to Neurofibromin 2 (NF2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Neurofibromin 2 (NF2)
MBS2060890-05 5 mL

PE-Linked Polyclonal Antibody to Neurofibromin 2 (NF2)

Sign In for Pricing
View Details