Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SCRG1 protein

This Human SCRG1 protein spans the amino acid sequence from region 21-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein Short name, ScRG-1

UniProt

O75711

Expression Region

21-98aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-API5 Polyclonal Antibody 2
TMAB-02747-01 50 μL

Anti-API5 Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-API5 Polyclonal Antibody 2
TMAB-02747-02 100 µL

Anti-API5 Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-API5 Polyclonal Antibody 2
TMAB-02747-03 200 µL

Anti-API5 Polyclonal Antibody 2

Sign In for Pricing
View Details
Chicken Endotrophin ELISA Kit
MBS7281154-01 48 Well

Chicken Endotrophin ELISA Kit

Sign In for Pricing
View Details
Chicken Endotrophin ELISA Kit
MBS7281154-02 96 Well

Chicken Endotrophin ELISA Kit

Sign In for Pricing
View Details
Chicken Endotrophin ELISA Kit
MBS7281154-03 5x 96 Well

Chicken Endotrophin ELISA Kit

Sign In for Pricing
View Details