Human SCRG1 protein
This Human SCRG1 protein spans the amino acid sequence from region 21-98aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Scrapie-responsive gene 1 protein Short name, ScRG-1
UniProt
O75711
Expression Region
21-98aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
24.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MXVPCR-25 25 tests/kit
Monkeypox Virus Molecular Detection Kit (Real-time PCR)
Sign In for Pricing
View Details C2404-06K1-HRP 100 µL
CD49b (CD49b Antigen, Alpha 2 Subunit of VLA2 Receptor, Alpha 2 Subunit of VLA-2 Receptor, Collagen Receptor, GPIa, Integrin alpha 2, ITGA2, Platelet Antigen Br, Platelet Glycoprotein GPIa, Platelet Glycoprotein Ia, Platelet Membrane Glycoprotein Ia, Very Late Activation Protein 2 Receptor alpha 2 Subunit, VLA2 alpha chain, VLA2, VLA-2 alpha chain, VLA-2, VLAA2) (HRP)
Sign In for Pricing
View Details 
MBS9318317-01 48 Well
Human Taste receptor type 1 member 3, TAS1R3 ELISA Kit
Sign In for Pricing
View Details MBS9318317-02 96 Well
Human Taste receptor type 1 member 3, TAS1R3 ELISA Kit
Sign In for Pricing
View Details