Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Cn2 protein

This Insect Cn2 protein spans the amino acid sequence from region 17-82aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Toxin II.9.2.2

UniProt

P01495

Expression Region

17-82aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Centruroides noxius (Mexican scorpion)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olodanrigan
MBS131826 Inquire

Olodanrigan

Sign In for Pricing
View Details
Recombinant Human PAG608
MBS7611384-01 0.05 mg

Recombinant Human PAG608

Sign In for Pricing
View Details
Recombinant Human PAG608
MBS7611384-02 0.2 mg

Recombinant Human PAG608

Sign In for Pricing
View Details
Recombinant Human PAG608
MBS7611384-03 1 mg

Recombinant Human PAG608

Sign In for Pricing
View Details
Recombinant Human PAG608
MBS7611384-04 5x 1 mg

Recombinant Human PAG608

Sign In for Pricing
View Details
Recombinant Caulobacter crescentus DNA topoisomerase 4 subunit A (parC), partial
MBS1106993 Inquire

Recombinant Caulobacter crescentus DNA topoisomerase 4 subunit A (parC), partial

Sign In for Pricing
View Details