Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal OP-3 protein

This Animal OP-3 protein spans the amino acid sequence from region 23-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antifreeze protein lambda OP-3

UniProt

P19606

Expression Region

23-91aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Zoarces americanus (Ocean pout) (Macrozoarces americanus)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 23-91aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD2 Antibody (118) [Janelia Fluor 549]
NBP2-89731JF549 0.1 mL

Rabbit Monoclonal CD2 Antibody (118) [Janelia Fluor 549]

Sign In for Pricing
View Details
PSMA Antibody [N17H9]
F1010-100uL 100 µL

PSMA Antibody [N17H9]

Sign In for Pricing
View Details
KCNMA1 Antibody
orb252638 100 µL

KCNMA1 Antibody

Sign In for Pricing
View Details
DEG-77
BA3742-25 25 mg

DEG-77

Sign In for Pricing
View Details
ATXN3L (NM_001135995) Human Tagged ORF Clone
RG227488 10 µg

ATXN3L (NM_001135995) Human Tagged ORF Clone

Sign In for Pricing
View Details
GC1q R (C1QBP) Rabbit Monoclonal Antibody
TA424317 100 µL

GC1q R (C1QBP) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details