Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human D104A protein (Active)

This Human D104A protein (Active) spans the amino acid sequence from region 23-72aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Beta-defensin 4, DEFB-4, hBD-4, Defensin, beta 104

UniProt

Q8WTQ1

Expression Region

23-72aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Microbiology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 0.1-100.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

6.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 130 mM NaCl

AA Sequence

EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Protein BTG1 (BTG1)
MBS950353-01 0.02 mg (E-Coli)

Recombinant Human Protein BTG1 (BTG1)

Sign In for Pricing
View Details
Recombinant Human Protein BTG1 (BTG1)
MBS950353-02 0.1 mg (E-Coli)

Recombinant Human Protein BTG1 (BTG1)

Sign In for Pricing
View Details
Recombinant Human Protein BTG1 (BTG1)
MBS950353-03 0.02 mg (Yeast)

Recombinant Human Protein BTG1 (BTG1)

Sign In for Pricing
View Details
Recombinant Human Protein BTG1 (BTG1)
MBS950353-04 0.1 mg (Yeast)

Recombinant Human Protein BTG1 (BTG1)

Sign In for Pricing
View Details
Recombinant Human Protein BTG1 (BTG1)
MBS950353-05 0.02 mg (Baculovirus)

Recombinant Human Protein BTG1 (BTG1)

Sign In for Pricing
View Details
Recombinant Human Protein BTG1 (BTG1)
MBS950353-06 0.02 mg (Mammalian-Cell)

Recombinant Human Protein BTG1 (BTG1)

Sign In for Pricing
View Details