Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human D103A protein (Active)

This Human D103A protein (Active) spans the amino acid sequence from region 23-67aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Beta-defensin 3, DEFB-3, HBD3, hBD-3, Defensin, beta 103

UniProt

P81534

Expression Region

23-67aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Microbiology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by anti-microbial activity against E.coli. is less than 30 μg/ml, corresponding to a specific activity of > 33.3 IU/mg.

Form

Lyophilized powder

Molecular Weight

5.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 130 mM NaCl

AA Sequence

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCP2 sterol-binding domain containing 1 Human Recombinant
rAP-4146 1 Each

SCP2 sterol-binding domain containing 1 Human Recombinant

Sign In for Pricing
View Details
GJA1 Antibody
orb1178537 100 µg

GJA1 Antibody

Sign In for Pricing
View Details
Human SHTN1 Pre-designed siRNA Set B
SI014762B 1 Each

Human SHTN1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lyme Disease (Borrelia burgdorferi) (APC)
MBS6126965-01 0.1 mL

Lyme Disease (Borrelia burgdorferi) (APC)

Sign In for Pricing
View Details
Lyme Disease (Borrelia burgdorferi) (APC)
MBS6126965-02 5x 0.1 mL

Lyme Disease (Borrelia burgdorferi) (APC)

Sign In for Pricing
View Details
Chicken Nucleoside diphosphokinase A (NME1) ELISA Kit
EIA07406Ch 1 Kit

Chicken Nucleoside diphosphokinase A (NME1) ELISA Kit

Sign In for Pricing
View Details