Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human D103A protein (Active)

This Human D103A protein (Active) spans the amino acid sequence from region 23-67aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Beta-defensin 3, DEFB-3, HBD3, hBD-3, Defensin, beta 103

UniProt

P81534

Expression Region

23-67aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Microbiology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by anti-microbial activity against E.coli. is less than 30 μg/ml, corresponding to a specific activity of > 33.3 IU/mg.

Form

Lyophilized powder

Molecular Weight

5.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 130 mM NaCl

AA Sequence

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM2B Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV799028 1.0 µg DNA

KDM2B Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
OR10R3P-set siRNA/shRNA/RNAi Lentivector (Human)
34911091 4x 500 ng

OR10R3P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Herc3 Mouse shRNA Plasmid (Locus ID 73998)
TR504877 1 Kit

Herc3 Mouse shRNA Plasmid (Locus ID 73998)

Sign In for Pricing
View Details
IL18R1 Antibody - N-terminal region : FITC (ARP46382_P050-FITC)
ARP46382_P050-FITC 100 µL

IL18R1 Antibody - N-terminal region : FITC (ARP46382_P050-FITC)

Sign In for Pricing
View Details
Cacng7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4514705 3x 1.0 µg

Cacng7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
AP4B1 Recombinant Protein (Mouse)
RP116285 100 µg

AP4B1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details