Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human D103A protein (Active)

This Human D103A protein (Active) spans the amino acid sequence from region 23-67aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Beta-defensin 3, DEFB-3, HBD3, hBD-3, Defensin, beta 103

UniProt

P81534

Expression Region

23-67aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Microbiology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by anti-microbial activity against E.coli. is less than 30 μg/ml, corresponding to a specific activity of > 33.3 IU/mg.

Form

Lyophilized powder

Molecular Weight

5.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 130 mM NaCl

AA Sequence

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-8 Monoclonal Antibody
UB-GEN-15272 100 µL

IL-8 Monoclonal Antibody

Sign In for Pricing
View Details
Quick Step Human connective tissue-activating peptide III, CTAPIII ELISA Kit
QS0519Hu-01 48 Tests

Quick Step Human connective tissue-activating peptide III, CTAPIII ELISA Kit

Sign In for Pricing
View Details
Quick Step Human connective tissue-activating peptide III, CTAPIII ELISA Kit
QS0519Hu-02 96 Tests

Quick Step Human connective tissue-activating peptide III, CTAPIII ELISA Kit

Sign In for Pricing
View Details
PKIG Protein Vector (Mouse) (pPB-C-His)
PV216574 500 ng

PKIG Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Mouse CC-chemokine receptor 1, CCR1 ELISA Kit
MBS7201515-01 48 Well

Mouse CC-chemokine receptor 1, CCR1 ELISA Kit

Sign In for Pricing
View Details
Mouse CC-chemokine receptor 1, CCR1 ELISA Kit
MBS7201515-02 96 Well

Mouse CC-chemokine receptor 1, CCR1 ELISA Kit

Sign In for Pricing
View Details