Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DFB4A protein (Active)

This Human DFB4A protein (Active) spans the amino acid sequence from region 24-64aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Beta-defensin 2, hBD-2, Defensin, beta 2, Skin-antimicrobial peptide 1, SAP1

UniProt

O15263

Expression Region

24-64aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Microbiology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

4.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 130 mM NaCl

AA Sequence

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza A H9N2 Hemagglutinin/HA Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8105125-01 0.02 mL

Influenza A H9N2 Hemagglutinin/HA Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
Influenza A H9N2 Hemagglutinin/HA Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8105125-02 0.1 mL

Influenza A H9N2 Hemagglutinin/HA Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
Influenza A H9N2 Hemagglutinin/HA Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8105125-03 5x 0.1 mL

Influenza A H9N2 Hemagglutinin/HA Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
FKBP2 Recombinant Protein (Mouse)
RP134726 100 µg

FKBP2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Follicle Stimulating Hormone alpha (FSHa) (MaxLight 405)
MBS6263228-01 0.1 mL

Follicle Stimulating Hormone alpha (FSHa) (MaxLight 405)

Sign In for Pricing
View Details
Follicle Stimulating Hormone alpha (FSHa) (MaxLight 405)
MBS6263228-02 5x 0.1 mL

Follicle Stimulating Hormone alpha (FSHa) (MaxLight 405)

Sign In for Pricing
View Details