Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DEFB1 protein (Active)

This Human DEFB1 protein (Active) spans the amino acid sequence from region 22-68aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

BD-1, Defensin, beta 1

UniProt

P60022

Expression Region

22-68aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using CD34+ dendritic cells is in a concentration range of 100.0-1000.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

5.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 130 mM NaCl

AA Sequence

GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anti-LPA/Lysophosphatidic acid Antibody (504B3)
MBS1580981-01 0.1 mg

Research Grade Anti-LPA/Lysophosphatidic acid Antibody (504B3)

Sign In for Pricing
View Details
Research Grade Anti-LPA/Lysophosphatidic acid Antibody (504B3)
MBS1580981-02 1 mg

Research Grade Anti-LPA/Lysophosphatidic acid Antibody (504B3)

Sign In for Pricing
View Details
Research Grade Anti-LPA/Lysophosphatidic acid Antibody (504B3)
MBS1580981-03 5x 1 mg

Research Grade Anti-LPA/Lysophosphatidic acid Antibody (504B3)

Sign In for Pricing
View Details
Zebrafish TWIST1A/1B/2 Rabbit Polyclonal Antibody (APC)
orb2817364 100 µg

Zebrafish TWIST1A/1B/2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
DEFB108B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
17922061 1.0 µg DNA

DEFB108B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
HnRNP K (phosphorylated Ser216)
319370 100 µL

HnRNP K (phosphorylated Ser216)

Sign In for Pricing
View Details