Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DEFB1 protein (Active)

This Human DEFB1 protein (Active) spans the amino acid sequence from region 22-68aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

BD-1, Defensin, beta 1

UniProt

P60022

Expression Region

22-68aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using CD34+ dendritic cells is in a concentration range of 100.0-1000.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

5.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 130 mM NaCl

AA Sequence

GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Adenylate Cyclase 8, Brain (ADCY8)
RPU54469-01 50 µg

Recombinant Adenylate Cyclase 8, Brain (ADCY8)

Sign In for Pricing
View Details
Recombinant Adenylate Cyclase 8, Brain (ADCY8)
RPU54469-02 100 µg

Recombinant Adenylate Cyclase 8, Brain (ADCY8)

Sign In for Pricing
View Details
Recombinant Adenylate Cyclase 8, Brain (ADCY8)
RPU54469-03 1 mg

Recombinant Adenylate Cyclase 8, Brain (ADCY8)

Sign In for Pricing
View Details
Pla2g4e 3'UTR GFP Stable Cell Line
TU266336 1.0 mL

Pla2g4e 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ARL6IP1 siRNA (Mouse)
CRM5475-01 15 nmol

ARL6IP1 siRNA (Mouse)

Sign In for Pricing
View Details
ARL6IP1 siRNA (Mouse)
CRM5475-02 30 nmol

ARL6IP1 siRNA (Mouse)

Sign In for Pricing
View Details