Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Midkine protein (Active)

This Human Midkine protein (Active) spans the amino acid sequence from region 21-143aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

MK, ARAP, Midgestation and kidney protein, Neurite outgrowth-promoting factor 2, Neurite outgrowth-promoting protein

UniProt

P21741

Expression Region

21-143aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 0.1-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PF-07238025
MBS5821019 Inquire

PF-07238025

Sign In for Pricing
View Details
Il6 Mouse Gene Knockout Kit (CRISPR)
KN508293 1 Kit

Il6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat Mrps15 Pre-designed siRNA Set B
SI208702B 1 Each

Rat Mrps15 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Polyclonal CEBP gamma Antibody [DyLight 350]
NBP2-96986UV 0.1 mL

Rabbit Polyclonal CEBP gamma Antibody [DyLight 350]

Sign In for Pricing
View Details
Phospho-PFKFB3/PFK2 (Ser467) Rabbit Polyclonal Antibody (APC-Cy7)
orb2431539 100 µL

Phospho-PFKFB3/PFK2 (Ser467) Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Enzaplatovir 1mg
A20830-1 1 mg

Enzaplatovir 1mg

Sign In for Pricing
View Details