Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Midkine protein (Active)

This Human Midkine protein (Active) spans the amino acid sequence from region 21-143aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

MK, ARAP, Midgestation and kidney protein, Neurite outgrowth-promoting factor 2, Neurite outgrowth-promoting protein

UniProt

P21741

Expression Region

21-143aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 0.1-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fruit fly VDAC Antibody, Dylight550 Conjugate
DZ41510-Dylight550 200 µL

Anti-Fruit fly VDAC Antibody, Dylight550 Conjugate

Sign In for Pricing
View Details
TMPRSS4 Antibody
DF12037-01 100 µL

TMPRSS4 Antibody

Sign In for Pricing
View Details
TMPRSS4 Antibody
DF12037-02 200 µL

TMPRSS4 Antibody

Sign In for Pricing
View Details
Flk-1 Rabbit Polyclonal Antibody
ES6017-01 50 µL

Flk-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Flk-1 Rabbit Polyclonal Antibody
ES6017-02 100 µL

Flk-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cesium (Cs) 10000 ppm Single Element Std. Soln. for ICP in H2 O Nist Traceable
815652-01 100 mL

Cesium (Cs) 10000 ppm Single Element Std. Soln. for ICP in H2 O Nist Traceable

Sign In for Pricing
View Details