Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Midkine protein (Active)

This Human Midkine protein (Active) spans the amino acid sequence from region 21-143aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

MK, ARAP, Midgestation and kidney protein, Neurite outgrowth-promoting factor 2, Neurite outgrowth-promoting protein

UniProt

P21741

Expression Region

21-143aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 0.1-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chemokine C-X-C-Motif Receptor 7 (CXCR7) Antibody
abx175825-01 200 µg

Chemokine C-X-C-Motif Receptor 7 (CXCR7) Antibody

Sign In for Pricing
View Details
Chemokine C-X-C-Motif Receptor 7 (CXCR7) Antibody
abx175825-02 1 mg

Chemokine C-X-C-Motif Receptor 7 (CXCR7) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal CHCHD6 Antibody
NBP2-81977 0.1 mg

Rabbit Polyclonal CHCHD6 Antibody

Sign In for Pricing
View Details
Citric Acid Anhydrous 99.5% Extrapure
00820 05000 5 Kg

Citric Acid Anhydrous 99.5% Extrapure

Sign In for Pricing
View Details
GAGE7 (NM_021123) Human Tagged ORF Clone Lentiviral Particle
RC204459L2V 200 µL

GAGE7 (NM_021123) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Bz-Arg-pNA · HCl
L-1130.1000 1.0g

Bz-Arg-pNA · HCl

Sign In for Pricing
View Details