Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AIMP1 protein (Active)

This Human AIMP1 protein (Active) spans the amino acid sequence from region 147-312aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Multisynthase complex auxiliary component p43, Endothelial monocyte-activating polypeptide II, EMAP-II, Small i

UniProt

Q12904

Expression Region

147-312aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by the apoptotic effect using serum free human MCF-7 cells is less than 40 ng/ml, corresponding to a specific activity of > 2.5 x 10 ^ 4 IU/mg.

Form

Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYNN siRNA (Mouse)
CRN0060-01 15 nmol

MYNN siRNA (Mouse)

Sign In for Pricing
View Details
MYNN siRNA (Mouse)
CRN0060-02 30 nmol

MYNN siRNA (Mouse)

Sign In for Pricing
View Details
SLC7A11 Protein (C-Flag Tag, )
P512277 100 µg

SLC7A11 Protein (C-Flag Tag, )

Sign In for Pricing
View Details
Annexin V-EGFP Reagent
1004-200 200 Assays

Annexin V-EGFP Reagent

Sign In for Pricing
View Details
Dishevelled 3 Rabbit Polyclonal Antibody (Cy3)
orb991160 100 µL

Dishevelled 3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Tauro-β-muricholic acid-d4 (sodium)
HY-135103S 1 Each

Tauro-β-muricholic acid-d4 (sodium)

Sign In for Pricing
View Details