Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral VMI2 protein (Active)

This Viral VMI2 protein (Active) spans the amino acid sequence from region 24-93aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Viral macrophage inflammatory protein II Short name:vMIP-II vMIP-1B

UniProt

Q98157

Expression Region

24-93aa

Tag

Tag-Free

Source

E.Coli

Origin

Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus)

Field of Research

Infectious Disease & Virology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The specific activity is determined by the inhibitory effect on monocyte migration response to human MIP-1 alpha using a concentration range of 1.0μg-10.0μg/ml of viral MIP-2 will inhibit 25ng/ml of human MIP-1 alpha.

Form

Lyophilized powder

Molecular Weight

8.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (Methylamino) propanoic acid
HY-W076705 1 Each

3- (Methylamino) propanoic acid

Sign In for Pricing
View Details
Human Chlamydia trachomatis antibody IgG,CT Ab IgG ELISA KIT
JOT-EKD0156Hu 96 wells

Human Chlamydia trachomatis antibody IgG,CT Ab IgG ELISA KIT

Sign In for Pricing
View Details
Anti-Human MUC17 Antibody (SAA1484), PE
FHJ04212 100 Tests

Anti-Human MUC17 Antibody (SAA1484), PE

Sign In for Pricing
View Details
Ghrelin Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2558077 100 µL

Ghrelin Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
VU0453379 hydrochloride
orb1983415-01 5 mg

VU0453379 hydrochloride

Sign In for Pricing
View Details
VU0453379 hydrochloride
orb1983415-02 50 mg

VU0453379 hydrochloride

Sign In for Pricing
View Details