Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral VMI2 protein (Active)

This Viral VMI2 protein (Active) spans the amino acid sequence from region 24-93aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Viral macrophage inflammatory protein II Short name:vMIP-II vMIP-1B

UniProt

Q98157

Expression Region

24-93aa

Tag

Tag-Free

Source

E.Coli

Origin

Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus)

Field of Research

Infectious Disease & Virology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The specific activity is determined by the inhibitory effect on monocyte migration response to human MIP-1 alpha using a concentration range of 1.0μg-10.0μg/ml of viral MIP-2 will inhibit 25ng/ml of human MIP-1 alpha.

Form

Lyophilized powder

Molecular Weight

8.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P-KV4.2 (C-6) P
sc-377574 P 100 µg - 0.5 mL

P-KV4.2 (C-6) P

Sign In for Pricing
View Details
Mouse anti Actin, Smooth Muscle Monoclonal Antibody
MBS460251-01 0.1 mg

Mouse anti Actin, Smooth Muscle Monoclonal Antibody

Sign In for Pricing
View Details
Mouse anti Actin, Smooth Muscle Monoclonal Antibody
MBS460251-02 5x 0.1 mg

Mouse anti Actin, Smooth Muscle Monoclonal Antibody

Sign In for Pricing
View Details
Anti-APP (Solanezumab)-MC-Vc-PAB-DMEA-(PEG2)-duocarmycin SA ADC
ADC-W-703 1 mg

Anti-APP (Solanezumab)-MC-Vc-PAB-DMEA-(PEG2)-duocarmycin SA ADC

Sign In for Pricing
View Details
(4-Fluorophenylthio) acetone
sc-261969 1 g

(4-Fluorophenylthio) acetone

Sign In for Pricing
View Details
SDA Growth Medium w/o LEU
G073-10X1L 1 unit

SDA Growth Medium w/o LEU

Sign In for Pricing
View Details