Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse FABPL protein (Active)

This Mouse FABPL protein (Active) spans the amino acid sequence from region 1-127aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

14 kDa selenium-binding protein, Liver-type fatty acid-binding protein, L-FABP

UniProt

P12710

Expression Region

1-127aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The binding affinity of rMuFABP1 for the synthetic ligand cis-parinaric acid has been measured by fluorescence titration. Half maximal fluorescence of 2.5 μM rMuFABP1 is achieved with approximately 5 μM cis-paranaric acid.

Form

Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4, 2 % trehalose.

AA Sequence

MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGB1 Antibody [APR31260G]
APR31260G-01 50 µL

HMGB1 Antibody [APR31260G]

Sign In for Pricing
View Details
HMGB1 Antibody [APR31260G]
APR31260G-02 100 µL

HMGB1 Antibody [APR31260G]

Sign In for Pricing
View Details
HMGB1 Antibody [APR31260G]
APR31260G-03 200 µL

HMGB1 Antibody [APR31260G]

Sign In for Pricing
View Details
HMGB1 Antibody [APR31260G]
APR31260G-04 400 µL

HMGB1 Antibody [APR31260G]

Sign In for Pricing
View Details
Rabbit Polyclonal EPB41L4A Antibody
NBP2-87367 100 µL

Rabbit Polyclonal EPB41L4A Antibody

Sign In for Pricing
View Details
1,2,3,6-Tetra-O-pivaloyl-α-D-galactofuranoside
orb2941424-01 250 mg

1,2,3,6-Tetra-O-pivaloyl-α-D-galactofuranoside

Sign In for Pricing
View Details