Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse FABPL protein (Active)

This Mouse FABPL protein (Active) spans the amino acid sequence from region 1-127aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

14 kDa selenium-binding protein, Liver-type fatty acid-binding protein, L-FABP

UniProt

P12710

Expression Region

1-127aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The binding affinity of rMuFABP1 for the synthetic ligand cis-parinaric acid has been measured by fluorescence titration. Half maximal fluorescence of 2.5 μM rMuFABP1 is achieved with approximately 5 μM cis-paranaric acid.

Form

Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4, 2 % trehalose.

AA Sequence

MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig PICK1 ELISA Kit
EGP0102 96 Tests

Guinea Pig PICK1 ELISA Kit

Sign In for Pricing
View Details
Anti-Human AUTS2 Polyclonal Antibody
PHK93901 100 μg

Anti-Human AUTS2 Polyclonal Antibody

Sign In for Pricing
View Details
Aquaporin 2 (Aqp2) Antibody (ATTO 633)
abx447338 100 µg

Aquaporin 2 (Aqp2) Antibody (ATTO 633)

Sign In for Pricing
View Details
L-threo- (+) -2-Amino-1- (4-nitrophenyl) -1,3-propanediol
FT28245-01 0.05 kg

L-threo- (+) -2-Amino-1- (4-nitrophenyl) -1,3-propanediol

Sign In for Pricing
View Details
L-threo- (+) -2-Amino-1- (4-nitrophenyl) -1,3-propanediol
FT28245-02 0.1 Kg

L-threo- (+) -2-Amino-1- (4-nitrophenyl) -1,3-propanediol

Sign In for Pricing
View Details
L-threo- (+) -2-Amino-1- (4-nitrophenyl) -1,3-propanediol
FT28245-03 0.25 kg

L-threo- (+) -2-Amino-1- (4-nitrophenyl) -1,3-propanediol

Sign In for Pricing
View Details