Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LEG3 protein (Active)

This Human LEG3 protein (Active) spans the amino acid sequence from region 2-250aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Gal-3, Carbohydrate-binding protein 35, CBP 35, Galactose-specific lectin 3, Galactoside-binding protein

UniProt

P17931

Expression Region

2-250aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to agglutinate human red blood cells is less than 10 μg/ml.

Form

Lyophilized powder

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 1 x PBS, pH 7.4, 3mM DTT

AA Sequence

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GP24 sp, Striped plate - Biochemical Identification System of Gram positive rods and cocci
C53MR1003 40 Tests/Set

GP24 sp, Striped plate - Biochemical Identification System of Gram positive rods and cocci

Sign In for Pricing
View Details
ADORA1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
11434066 1.0 µg DNA

ADORA1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Major Histocompatibility Complex Class I E (HLA-E) ELISA Kit
abx252754 96 Well

Human Major Histocompatibility Complex Class I E (HLA-E) ELISA Kit

Sign In for Pricing
View Details
MCFD2L sgRNA CRISPR Lentivector (Human) (Target 1)
K1279502 1.0 µg DNA

MCFD2L sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
RELA Antibody
orb675258-01 50 µg

RELA Antibody

Sign In for Pricing
View Details
RELA Antibody
orb675258-02 100 µg

RELA Antibody

Sign In for Pricing
View Details