Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LEG3 protein (Active)

This Human LEG3 protein (Active) spans the amino acid sequence from region 2-250aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Gal-3, Carbohydrate-binding protein 35, CBP 35, Galactose-specific lectin 3, Galactoside-binding protein

UniProt

P17931

Expression Region

2-250aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to agglutinate human red blood cells is less than 10 μg/ml.

Form

Lyophilized powder

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 1 x PBS, pH 7.4, 3mM DTT

AA Sequence

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

YELLOW Lysis Kit 250 pack
YELLOWE5 250 Preparations

YELLOW Lysis Kit 250 pack

Sign In for Pricing
View Details
ST3GAL3 Human Over-expression Lysate
orb1354143 100 µg

ST3GAL3 Human Over-expression Lysate

Sign In for Pricing
View Details
Bovine Anosmin-1 (KAL1) ELISA Kit
MBS7232423-01 48 Well

Bovine Anosmin-1 (KAL1) ELISA Kit

Sign In for Pricing
View Details
Bovine Anosmin-1 (KAL1) ELISA Kit
MBS7232423-02 96 Well

Bovine Anosmin-1 (KAL1) ELISA Kit

Sign In for Pricing
View Details
Bovine Anosmin-1 (KAL1) ELISA Kit
MBS7232423-03 5x 96 Well

Bovine Anosmin-1 (KAL1) ELISA Kit

Sign In for Pricing
View Details
Bovine Anosmin-1 (KAL1) ELISA Kit
MBS7232423-04 10x 96 Well

Bovine Anosmin-1 (KAL1) ELISA Kit

Sign In for Pricing
View Details