Human NGAL protein (Active)

Lcn 2 protein, Lcn-2 protein, Lcn2 protein, Lipocalin-2 protein, Lipocalin 2 protein, Migration stimulating factor inhibitor protein, MSFI protein, Neutrophil gelatinase associated lipocalin protein, Neutrophil gelatinase associated lipocalin precursor protein, NGAL protein, Oncogene 24p3 protein, Oncogenic lipocalin 24p3 protein, Siderocalin protein, siderocalin LCN2 protein, SV40 induced 24P3 protein protein, Uterocalin protein, 25 kDa alpha 2 microglobulin related subunit of MMP9 protein, Alpha 2 microglobulin related protein protein, HNL protein

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 6 IU/mg.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG