Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DHH protein (Active)

This Human DHH protein (Active) spans the amino acid sequence from region 24-198aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

DHH

UniProt

O43323

Expression Region

24-198aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2 (CCL-226) cells is 15-45 μg/ml.

Form

Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 10mM PB, pH 6.0, 300mM NaCl

AA Sequence

II+GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KD-Validated Anti-Linker For Activation Of T Cells Rabbit Monoclonal Antibody
AGI1868-100 100 µL

KD-Validated Anti-Linker For Activation Of T Cells Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Hsa-miR-3170 miRNA Antagomir
orb1915350-01 10 nmol

Hsa-miR-3170 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-3170 miRNA Antagomir
orb1915350-02 20 nmol

Hsa-miR-3170 miRNA Antagomir

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)
MBS2106343-01 0.1 mL

PE-Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)
MBS2106343-02 0.2 mL

PE-Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)
MBS2106343-03 0.5 mL

PE-Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details