Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TYB4 protein (Active)

This Human TYB4 protein (Active) spans the amino acid sequence from region 2-44aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

T beta-4

UniProt

P62328

Expression Region

2-44aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by its ability to produce a protective effect against hydrogen peroxide in primary lung fibroblasts is in a concentration range of 0.5 - 10 μg/ml.

Form

Lyophilized powder

Molecular Weight

4.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4.

AA Sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peli2 Rat Pre-designed siRNA Set A
HY-RS29233 1 Set

Peli2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus Membrane protein insertase YidC (yidC)
orb2914473-01 20 µg

Recombinant Thermosynechococcus elongatus Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus Membrane protein insertase YidC (yidC)
orb2914473-02 100 µg

Recombinant Thermosynechococcus elongatus Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Brucella canis Glutamate racemase (murI)
MBS1107867-01 0.02 mg (E-Coli)

Recombinant Brucella canis Glutamate racemase (murI)

Sign In for Pricing
View Details
Recombinant Brucella canis Glutamate racemase (murI)
MBS1107867-02 0.02 mg (Yeast)

Recombinant Brucella canis Glutamate racemase (murI)

Sign In for Pricing
View Details
Recombinant Brucella canis Glutamate racemase (murI)
MBS1107867-03 0.1 mg (E-Coli)

Recombinant Brucella canis Glutamate racemase (murI)

Sign In for Pricing
View Details