Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SHH protein (Active)

This Human SHH protein (Active) spans the amino acid sequence from region 25-197aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

SHH

UniProt

Q15465

Expression Region

25-197aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine C3H/10T1/2 cells is less than 1 μg/ml, corresponding to a specific activity of > 1.0 x 10 ^ 3 IU/mg.

Form

Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 150mM NaCl

AA Sequence

IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3a,5b,12a) -3,12-Dihydroxy-7-oxocholan-24-oic acid methyl ester
FD145354-01 5 g

(3a,5b,12a) -3,12-Dihydroxy-7-oxocholan-24-oic acid methyl ester

Sign In for Pricing
View Details
(3a,5b,12a) -3,12-Dihydroxy-7-oxocholan-24-oic acid methyl ester
FD145354-02 10 g

(3a,5b,12a) -3,12-Dihydroxy-7-oxocholan-24-oic acid methyl ester

Sign In for Pricing
View Details
(3a,5b,12a) -3,12-Dihydroxy-7-oxocholan-24-oic acid methyl ester
FD145354-03 25 g

(3a,5b,12a) -3,12-Dihydroxy-7-oxocholan-24-oic acid methyl ester

Sign In for Pricing
View Details
(3a,5b,12a) -3,12-Dihydroxy-7-oxocholan-24-oic acid methyl ester
FD145354-04 50 g

(3a,5b,12a) -3,12-Dihydroxy-7-oxocholan-24-oic acid methyl ester

Sign In for Pricing
View Details
CaMKIIδ CRISPR Activation Plasmid (m2)
sc-430792-ACT-2 20 µg

CaMKIIδ CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Midnolin Rabbit Polyclonal Antibody (AP)
orb913160 100 µL

Midnolin Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details