Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SHH protein (Active)

This Human SHH protein (Active) spans the amino acid sequence from region 25-197aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

SHH

UniProt

Q15465

Expression Region

25-197aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine C3H/10T1/2 cells is less than 1 μg/ml, corresponding to a specific activity of > 1.0 x 10 ^ 3 IU/mg.

Form

Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 150mM NaCl

AA Sequence

IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus halodurans Catalase-peroxidase (katG), partial
MBS1307572 Inquire

Recombinant Bacillus halodurans Catalase-peroxidase (katG), partial

Sign In for Pricing
View Details
Rabbit Monoclonal EZH2/KMT6 Antibody (S07-5B1)
NBP3-19672-100ul 100 µL

Rabbit Monoclonal EZH2/KMT6 Antibody (S07-5B1)

Sign In for Pricing
View Details
Cyp3a44-set siRNA/shRNA/RNAi Lentivector (Mouse)
17451094 4x 500 ng

Cyp3a44-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
REST-Luc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat/Mouse)
K9000405 3x 1.0 µg

REST-Luc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat/Mouse)

Sign In for Pricing
View Details
DSPP Lentiviral Activation Particles (m2)
sc-437094-LAC-2 200 µL

DSPP Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
CDC42SE2 Antibody
orb1315620-01 30 µL

CDC42SE2 Antibody

Sign In for Pricing
View Details