Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TFF3 protein (Active)

This Human TFF3 protein (Active) spans the amino acid sequence from region 22-80aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Intestinal trefoil factor, Polypeptide P1.B, hP1.B

UniProt

Q07654

Expression Region

22-80aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10 μg/ml, corresponding to a specific activity of > 100 IU/mg.

Form

Lyophilized powder

Molecular Weight

6.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 150mM NaCl

AA Sequence

EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCAM Antibody / CD56
V4201SAF-100UG 100 µg

NCAM Antibody / CD56

Sign In for Pricing
View Details
Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, beta-GR, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (AP) discontinued
D1876-48P-AP 100 µL

Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, beta-GR, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (AP) discontinued

Sign In for Pricing
View Details
H-Trp-Lys-OH
4002439.1 1 g

H-Trp-Lys-OH

Sign In for Pricing
View Details
Bovine Radixin (RDX) ELISA Kit
MBS7249842-01 48 Well

Bovine Radixin (RDX) ELISA Kit

Sign In for Pricing
View Details
Bovine Radixin (RDX) ELISA Kit
MBS7249842-02 96 Well

Bovine Radixin (RDX) ELISA Kit

Sign In for Pricing
View Details
Bovine Radixin (RDX) ELISA Kit
MBS7249842-03 5x 96 Well

Bovine Radixin (RDX) ELISA Kit

Sign In for Pricing
View Details