Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TFF2 protein (Active)

This Human TFF2 protein (Active) spans the amino acid sequence from region 24-129aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Spasmolysin, SP

UniProt

Q03403

Expression Region

24-129aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

12.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 130mM NaCl

AA Sequence

EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIKV Capsid C/Core Protein (N-GST & C-His, Zika virus (ZIKV) )
P509859 100 µg

ZIKV Capsid C/Core Protein (N-GST & C-His, Zika virus (ZIKV) )

Sign In for Pricing
View Details
Calsequestrin 2 Antibody (YA6527, Rabbit)
HY-P86834-01 10 µL

Calsequestrin 2 Antibody (YA6527, Rabbit)

Sign In for Pricing
View Details
Calsequestrin 2 Antibody (YA6527, Rabbit)
HY-P86834-02 50 μL

Calsequestrin 2 Antibody (YA6527, Rabbit)

Sign In for Pricing
View Details
Calsequestrin 2 Antibody (YA6527, Rabbit)
HY-P86834-03 100 µL

Calsequestrin 2 Antibody (YA6527, Rabbit)

Sign In for Pricing
View Details
Recombinant Human NTRK3 Protein
E30P511 20 µg

Recombinant Human NTRK3 Protein

Sign In for Pricing
View Details
Human HOXC9 Knockout A549 cell line
GTR15405017 1 Vial

Human HOXC9 Knockout A549 cell line

Sign In for Pricing
View Details