Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SDC4 protein (Active)

This Human SDC4 protein (Active) spans the amino acid sequence from region 19-145aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

SYND4, Ryudocan core protein

UniProt

P31431

Expression Region

19-145aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The specific activity is determined by binding ability in a functional ELISA. Immobilized rHuSYND4 at 500 ng/ml (100 μl/well) can bind rHubFGF with a linear range of 0.1-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Op18 discontinued
345064-01 100 µL

Op18 discontinued

Sign In for Pricing
View Details
Op18 discontinued
345064-02 200 µL

Op18 discontinued

Sign In for Pricing
View Details
Anti-Mouse-ear cress AtURI Antibody HRP Conjugated
DZ41764-HRP 200 µL/Vial

Anti-Mouse-ear cress AtURI Antibody HRP Conjugated

Sign In for Pricing
View Details
PCAG-3xFLAG-OR14I1 (human) -EGFP-StrepII
BZ61818 1 Vial

PCAG-3xFLAG-OR14I1 (human) -EGFP-StrepII

Sign In for Pricing
View Details
Rat Thymus Activation Regulated Chemokine (TARC) ELISA Kit
JL15766-01 48 Tests

Rat Thymus Activation Regulated Chemokine (TARC) ELISA Kit

Sign In for Pricing
View Details
Rat Thymus Activation Regulated Chemokine (TARC) ELISA Kit
JL15766-02 96 Tests

Rat Thymus Activation Regulated Chemokine (TARC) ELISA Kit

Sign In for Pricing
View Details