Human SDC4 protein (Active)
This Human SDC4 protein (Active) spans the amino acid sequence from region 19-145aa. Purity: > 95% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
SYND4, Ryudocan core protein
UniProt
P31431
Expression Region
19-145aa
Tag
Tag-Free
Source
E.Coli
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 95% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The specific activity is determined by binding ability in a functional ELISA. Immobilized rHuSYND4 at 500 ng/ml (100 μl/well) can bind rHubFGF with a linear range of 0.1-10 ng/ml.
Form
Lyophilized powder
Molecular Weight
13.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, pH 7.4
AA Sequence
ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
123754-APC 100 µL
ATRX (Transcriptional Regulator ATRX, ATP-dependent Helicase ATRX, X-linked Helicase II, X-linked Nuclear Protein, XNP, Znf-HX, ATRX, RAD54L, XH2) (APC)
Sign In for Pricing
View Details 
358774-01 48 Tests
SEMA5A (Semaphorin-5A) BioAssayTM ELISA Kit (Human) discontinued
Sign In for Pricing
View Details 358774-02 96 Tests
SEMA5A (Semaphorin-5A) BioAssayTM ELISA Kit (Human) discontinued
Sign In for Pricing
View Details 