Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat UTER protein (Active)

This Rat UTER protein (Active) spans the amino acid sequence from region 20-96aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Clara cell phospholipid-binding protein, Clara cells 10 kDa secretory protein, CC10, PCB-binding protein, Secretoglobin family 1A member 1

UniProt

P17559

Expression Region

20-96aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by the ability of the immobilized protein to support the adhesion of the A549 human lung carcinoma cells is less than 5.0 μg/ml, corresponding to a specific activity of > 200 IU/m.

Form

Lyophilized powder

Molecular Weight

8.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 150mM NaCl

AA Sequence

SSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLCEQDLRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Frizzled-1 / FZD1 Protein (His tag)
ARP8204-01 10 µg

Recombinant Mouse Frizzled-1 / FZD1 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Frizzled-1 / FZD1 Protein (His tag)
ARP8204-02 50 µg

Recombinant Mouse Frizzled-1 / FZD1 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Frizzled-1 / FZD1 Protein (His tag)
ARP8204-03 100 µg

Recombinant Mouse Frizzled-1 / FZD1 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Frizzled-1 / FZD1 Protein (His tag)
ARP8204-04 1 mg

Recombinant Mouse Frizzled-1 / FZD1 Protein (His tag)

Sign In for Pricing
View Details
SNAP-Block
HY-D2934 1 Each

SNAP-Block

Sign In for Pricing
View Details
PF 670462
256217-01 10 mg

PF 670462

Sign In for Pricing
View Details