Rat UTER protein (Active)
This Rat UTER protein (Active) spans the amino acid sequence from region 20-96aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
Clara cell phospholipid-binding protein, Clara cells 10 kDa secretory protein, CC10, PCB-binding protein, Secretoglobin family 1A member 1
UniProt
P17559
Expression Region
20-96aa
Tag
Tag-Free
Source
E.Coli
Origin
Rattus norvegicus (Rat)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 97% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by the ability of the immobilized protein to support the adhesion of the A549 human lung carcinoma cells is less than 5.0 μg/ml, corresponding to a specific activity of > 200 IU/m.
Form
Lyophilized powder
Molecular Weight
8.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 150mM NaCl
AA Sequence
SSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLCEQDLRV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6223636-01 0.1 mL
PAK2 (Serine/Threonine-protein Kinase PAK 2, Gamma-PAK, PAK65, S6/H4 Kinase, p21-activated Kinase 2, PAK-2, p58) (MaxLight 650)
Sign In for Pricing
View Details MBS6223636-02 5x 0.1 mL
PAK2 (Serine/Threonine-protein Kinase PAK 2, Gamma-PAK, PAK65, S6/H4 Kinase, p21-activated Kinase 2, PAK-2, p58) (MaxLight 650)
Sign In for Pricing
View Details MBS8121937-01 0.1 mg
MZB1/PERP1 Protein, Human, Recombinant (hFc Tag)
Sign In for Pricing
View Details MBS8121937-02 5x 0.1 mg
MZB1/PERP1 Protein, Human, Recombinant (hFc Tag)
Sign In for Pricing
View Details 
MBS6308415-01 0.1 mL
HRIHFB2025, CT (CBY1, ARB1, C22orf2, CBY, PGEA1, Protein chibby homolog 1, ARPP-binding protein, Cytosolic leucine-rich protein, PIGEA-14, PKD2 interactor, Golgi and endoplasmic reticulum-associated 1) (MaxLight 550)
Sign In for Pricing
View Details