Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial STRP protein (Active)

This Bacterial STRP protein (Active) spans the amino acid sequence from region 27-440aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

UniProt

P10519

Expression Region

27-440aa

Tag

Tag-Free

Source

E.Coli

Origin

Streptococcus sp. (strain 19909)

Field of Research

Infectious Disease & Virology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The specific activity determined by fibrining lysis in agarose plate is 8.0 x 104 IU/mg.

Form

Lyophilized powder

Molecular Weight

47.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

IAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKLFATDSGAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPIQPVQEFLLKGHVRVRPYKEKPVQNQAKSVDVEYTVQFTPLNPDDDFRPALKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant α smooth muscle actin Monoclonal Antibody
AN301012L-01 50 µL

Recombinant α smooth muscle actin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant α smooth muscle actin Monoclonal Antibody
AN301012L-02 100 µL

Recombinant α smooth muscle actin Monoclonal Antibody

Sign In for Pricing
View Details
Wnt8a sgRNA CRISPR Lentivector set (Mouse)
K3875301 3x 1.0 µg

Wnt8a sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Endou sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3369602 1.0 µg DNA

Endou sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Human Multiple Inositol Polyphosphate Phosphatase 1/MINPP1 (C-6His)
orb1649195-01 10 µg

Recombinant Human Multiple Inositol Polyphosphate Phosphatase 1/MINPP1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Multiple Inositol Polyphosphate Phosphatase 1/MINPP1 (C-6His)
orb1649195-02 50 µg

Recombinant Human Multiple Inositol Polyphosphate Phosphatase 1/MINPP1 (C-6His)

Sign In for Pricing
View Details