Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NEUS protein (Active)

This Human NEUS protein (Active) spans the amino acid sequence from region 17-410aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Peptidase inhibitor 12, Serpin I1

UniProt

Q99574

Expression Region

17-410aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat C6 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2000 IU/mg.

Form

Lyophilized powder

Molecular Weight

44.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.5

AA Sequence

TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea-pig PIIINP (N-Terminal Procollagen III Propeptide) ValidElisa Kit
EK347857 96 Well

Guinea-pig PIIINP (N-Terminal Procollagen III Propeptide) ValidElisa Kit

Sign In for Pricing
View Details
LDLR siRNA (h)
sc-35802 10 µM

LDLR siRNA (h)

Sign In for Pricing
View Details
Mouse LEMD1 siRNA
abx922421-01 15 nmol

Mouse LEMD1 siRNA

Sign In for Pricing
View Details
Mouse LEMD1 siRNA
abx922421-02 30 nmol

Mouse LEMD1 siRNA

Sign In for Pricing
View Details
M6PR Human shRNA Plasmid Kit (Locus ID 4074)
TG311629 1 Kit

M6PR Human shRNA Plasmid Kit (Locus ID 4074)

Sign In for Pricing
View Details
HELZ2 Human shRNA Plasmid Kit (Locus ID 85441)
TL315389 1 Kit

HELZ2 Human shRNA Plasmid Kit (Locus ID 85441)

Sign In for Pricing
View Details