Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFB protein (Active)

This Human TNFB protein (Active) spans the amino acid sequence from region 35-205aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

LT-alpha, Tumor necrosis factor ligand superfamily member 1

UniProt

P01374

Expression Region

35-205aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 5 pg/ml, corresponding to a specific activity of > 2.0 x 10 ^ 8 IU/mg in the presence of actinomycin D.

Form

Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, with 0.02 % Tween-20

AA Sequence

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inpp5a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
24981116 3x 1.0 µg

Inpp5a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
p53 (Acetyl Lys373) Polyclonal Antibody
MBS9241350-01 0.1 mL

p53 (Acetyl Lys373) Polyclonal Antibody

Sign In for Pricing
View Details
p53 (Acetyl Lys373) Polyclonal Antibody
MBS9241350-02 5x 0.1 mL

p53 (Acetyl Lys373) Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Lysyl Oxidase Like Protein 2 (LOXL2) ELISA Kit
orb1665020-01 48 Tests

Mouse Lysyl Oxidase Like Protein 2 (LOXL2) ELISA Kit

Sign In for Pricing
View Details
Mouse Lysyl Oxidase Like Protein 2 (LOXL2) ELISA Kit
orb1665020-02 96 Tests

Mouse Lysyl Oxidase Like Protein 2 (LOXL2) ELISA Kit

Sign In for Pricing
View Details
C11orf80 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0287408 1.0 µg DNA

C11orf80 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details