Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNW1 protein (Active)

This Human IFNW1 protein (Active) spans the amino acid sequence from region 24-195aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Interferon alpha-II-1

UniProt

P05000

Expression Region

24-195aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human TF-1 cells is less than 0.01 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 8 IU/mg.

Form

Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VN1R109P Recombinant Protein (Human)
RP107066 100 µg

VN1R109P Recombinant Protein (Human)

Sign In for Pricing
View Details
Hsa-miR-627-5p miRNA Agomir
CMJ0402-01 5 nmol

Hsa-miR-627-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-627-5p miRNA Agomir
CMJ0402-02 10 nmol

Hsa-miR-627-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-627-5p miRNA Agomir
CMJ0402-03 20 nmol

Hsa-miR-627-5p miRNA Agomir

Sign In for Pricing
View Details
Mouse Glutaminase (GLS) ELISA Kit-Sandwich
EK6F146-01 48 Test

Mouse Glutaminase (GLS) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Glutaminase (GLS) ELISA Kit-Sandwich
EK6F146-02 96 Tests

Mouse Glutaminase (GLS) ELISA Kit-Sandwich

Sign In for Pricing
View Details