What is the catalog number for Human IFNA1 protein (Active)?

The catalog number for Human IFNA1 protein (Active) is orb359209.

What sizes are available for Human IFNA1 protein (Active)?

Human IFNA1 protein (Active) is available in the following size(s): 10 µg, 100 µg, 500 µg.

How many pack sizes does Human IFNA1 protein (Active) come in?

Human IFNA1 protein (Active) is available in 3 different pack sizes.

Is Human IFNA1 protein (Active) in stock?

Human IFNA1 protein (Active) is currently made to order / not held in immediate stock. Contact us for lead time.

Human IFNA1 protein (Active)

This Human IFNA1 protein (Active) spans the amino acid sequence from region 24-189aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IFN-alpha-1/13, LeIF D

UniProt

P01562

Expression Region

24-189aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 1.0 x 10 ^ 8 IU/mg.

Form

Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, containing 4 % mannitol and 1 % HSA

AA Sequence

M+CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNVDSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE