Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNA1 protein (Active)

This Human IFNA1 protein (Active) spans the amino acid sequence from region 24-189aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

IFN-alpha-1/13, LeIF D

UniProt

P01562

Expression Region

24-189aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 1.0 x 10 ^ 8 IU/mg.

Form

Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, containing 3 % Mannitol, 5 % Trehalose, 0.05 % Tween-80

AA Sequence

M+CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Vanbaalenii mprA Protein (aa 1-231)
VAng-Yyj5078-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Vanbaalenii mprA Protein (aa 1-231)

Sign In for Pricing
View Details
Human Betacellulin Construction Kit
RHF122CK 960 Tests

Human Betacellulin Construction Kit

Sign In for Pricing
View Details
Recombinant Rhizobium sp. Probable conjugal transfer protein traB (traB), partial
MBS1248201-01 1 mg (E-Coli)

Recombinant Rhizobium sp. Probable conjugal transfer protein traB (traB), partial

Sign In for Pricing
View Details
Recombinant Rhizobium sp. Probable conjugal transfer protein traB (traB), partial
MBS1248201-02 1 mg (Yeast)

Recombinant Rhizobium sp. Probable conjugal transfer protein traB (traB), partial

Sign In for Pricing
View Details
LOC100912020 Rabbit Polyclonal Antibody
orb324730 100 µL

LOC100912020 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Polyclonal Anti-CG17352 target 1 Antibody, Dylight550 Conjugate
DZ33940-Dylight550 200 µL

Polyclonal Anti-CG17352 target 1 Antibody, Dylight550 Conjugate

Sign In for Pricing
View Details