Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNR1B protein (Active)

This Human TNR1B protein (Active) spans the amino acid sequence from region 23-206aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor 2, Tumor necrosis factor receptor type II, TNF-RII, TNFR-II, p75

UniProt

P20333

Expression Region

23-206aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-α mediated cytotoxicity in the L-929 cells is less than 0.2 μg/ml, corresponding to a specific activity of > 5000 IU/mg in the presence of 0.25 ng/mL of rHuTNF-α.

Form

Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

M+PAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S506 Recombinant Protein (Human)
RP088296 100 µg

RN5S506 Recombinant Protein (Human)

Sign In for Pricing
View Details
PerCP-Cy5.5 human CD127 Antibody
orb3065812-01 25 Tests

PerCP-Cy5.5 human CD127 Antibody

Sign In for Pricing
View Details
PerCP-Cy5.5 human CD127 Antibody
orb3065812-02 100 Tests

PerCP-Cy5.5 human CD127 Antibody

Sign In for Pricing
View Details
KALRN
321354 100 µL

KALRN

Sign In for Pricing
View Details
OAT2/SLC22A7 Rabbit Polyclonal Antibody (Biotin)
orb2594471 100 µg

OAT2/SLC22A7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
S-[N-Benzyl (thiocarbamoyl) ]-L-cysteine
262331-01 50 mg

S-[N-Benzyl (thiocarbamoyl) ]-L-cysteine

Sign In for Pricing
View Details