Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNR1A protein (Active)

This Human TNR1A protein (Active) spans the amino acid sequence from region 22-211aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-RI, TNFR-I, p55

UniProt

P19438

Expression Region

22-211aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L-929 cells is less than 0.05 μg/ml, corresponding to a specific activity of > 2.0 x 10 ^ 4 IU/mg in the presence of 0.25 ng/mL of rHuTNF-alpha.

Form

Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCPS (NM_014026) Human Tagged Lenti ORF Clone
RC203052L3 10 µg

DCPS (NM_014026) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OAEC04562-100UL - TBL1X Antibody
OAEC04562-100UL 100 µg / 100 µL

OAEC04562-100UL - TBL1X Antibody

Sign In for Pricing
View Details
Sheep Mullerian Inhibiting Substance/Anti-Mullerian hormone (MIS/AMH) ELISA Kit
MBS2801727-01 48 Tests

Sheep Mullerian Inhibiting Substance/Anti-Mullerian hormone (MIS/AMH) ELISA Kit

Sign In for Pricing
View Details
Sheep Mullerian Inhibiting Substance/Anti-Mullerian hormone (MIS/AMH) ELISA Kit
MBS2801727-02 96 Tests

Sheep Mullerian Inhibiting Substance/Anti-Mullerian hormone (MIS/AMH) ELISA Kit

Sign In for Pricing
View Details
Sheep Mullerian Inhibiting Substance/Anti-Mullerian hormone (MIS/AMH) ELISA Kit
MBS2801727-03 5x 96 Tests

Sheep Mullerian Inhibiting Substance/Anti-Mullerian hormone (MIS/AMH) ELISA Kit

Sign In for Pricing
View Details
Sheep Mullerian Inhibiting Substance/Anti-Mullerian hormone (MIS/AMH) ELISA Kit
MBS2801727-04 10x 96 Tests

Sheep Mullerian Inhibiting Substance/Anti-Mullerian hormone (MIS/AMH) ELISA Kit

Sign In for Pricing
View Details