Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNF18 protein (Active)

This Human TNF18 protein (Active) spans the amino acid sequence from region 74-199aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Activation-inducible TNF-related ligand, Glucocorticoid-induced TNF-related ligand, hGITRL

UniProt

Q9UNG2

Expression Region

74-199aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity as determined by stimulation of IL-8 production using human PBMC is in a concentration range of 0.1-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-HEV E2 IgG
E4A11A14-G-100 100 µg

Human anti-HEV E2 IgG

Sign In for Pricing
View Details
Cluster of Differentiation 99 (CD99) Chicken ELISA Kit
C2420 96 Tests

Cluster of Differentiation 99 (CD99) Chicken ELISA Kit

Sign In for Pricing
View Details
PTEN Tumor Suppressor Protein (PTEN, MMAC1, Phosphatase and Tensin Homolog, TEP1) (MaxLight 650)
MBS6246582-01 0.1 mL

PTEN Tumor Suppressor Protein (PTEN, MMAC1, Phosphatase and Tensin Homolog, TEP1) (MaxLight 650)

Sign In for Pricing
View Details
PTEN Tumor Suppressor Protein (PTEN, MMAC1, Phosphatase and Tensin Homolog, TEP1) (MaxLight 650)
MBS6246582-02 5x 0.1 mL

PTEN Tumor Suppressor Protein (PTEN, MMAC1, Phosphatase and Tensin Homolog, TEP1) (MaxLight 650)

Sign In for Pricing
View Details
KLF11
401644-01 50 µL

KLF11

Sign In for Pricing
View Details
KLF11
401644-02 100 µL

KLF11

Sign In for Pricing
View Details