Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNF15 protein (Active)

This Human TNF15 protein (Active) spans the amino acid sequence from region 72-251aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

TNF ligand-related molecule 1

UniProt

O95150

Expression Region

72-251aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to induce apoptosis using human TF-1 cells is less than 20 ng/ml, corresponding to a specific activity of > 5.0 x 10 ^ 4 IU/mg.

Form

Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, with 0.02% Tween-20

AA Sequence

LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Snapc4 Pre-designed siRNA Set B
SI213430B 1 Each

Rat Snapc4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
BNC1 Rabbit Polyclonal Antibody (BF350)
orb2459720 100 µL

BNC1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
TrkB (Phospho-Tyr515) Antibody
orb14990-01 50 μL

TrkB (Phospho-Tyr515) Antibody

Sign In for Pricing
View Details
TrkB (Phospho-Tyr515) Antibody
orb14990-02 100 µL

TrkB (Phospho-Tyr515) Antibody

Sign In for Pricing
View Details
Gm10731 3'UTR Luciferase Stable Cell Line
TU107345 1.0 mL

Gm10731 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Beta-actin ELISA Kit
MBS1602853-01 48 Well

Human Beta-actin ELISA Kit

Sign In for Pricing
View Details