Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNR11 protein (Active)

This Human TNR11 protein (Active) spans the amino acid sequence from region 29-202aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Osteoclast differentiation factor receptor, Receptor activator of NF-KB, CD antigen CD265

UniProt

Q9Y6Q6

Expression Region

29-202aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit sRANK Ligand induced nuclear factor kappa B (NFkappaB) in RAW 264.7 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 4 IU/mg in the presence of 15 ng/ml of recombinant sRANK Ligand.

Form

Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, pH 8.0, 150mM NaCl

AA Sequence

QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Exenatide
4019602.1000 1 mg

Exenatide

Sign In for Pricing
View Details
Lentiviral human APIP sgRNA gene knockout kit - Lentiviral human APIP sgRNA gene knockout kit (100)
GTR15374797 1 Vial

Lentiviral human APIP sgRNA gene knockout kit - Lentiviral human APIP sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
TPD52L3 Antibody
CSB-PA070195-01 50 µg

TPD52L3 Antibody

Sign In for Pricing
View Details
TPD52L3 Antibody
CSB-PA070195-02 100 µg

TPD52L3 Antibody

Sign In for Pricing
View Details
Fatty Acid Binding Protein 4 Human Recombinant, His Tag (FABP4 Human, His)
PT_74199-01 5 µg

Fatty Acid Binding Protein 4 Human Recombinant, His Tag (FABP4 Human, His)

Sign In for Pricing
View Details
Fatty Acid Binding Protein 4 Human Recombinant, His Tag (FABP4 Human, His)
PT_74199-02 25 µg

Fatty Acid Binding Protein 4 Human Recombinant, His Tag (FABP4 Human, His)

Sign In for Pricing
View Details