Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TR10B protein (Active)

This Human TR10B protein (Active) spans the amino acid sequence from region 52-183aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Death receptor 5, TRAIL receptor 2, TRAIL-R2, CD antigen CD262

UniProt

O14763

Expression Region

52-183aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. rHusTRAIL-R2 reduced the production of LPS- induced TNF by its ability to neutralize endogenous TRAIL in fresh human PBMC. In this assay, endogenous TRAIL is induced during a 24 hour exposure to LPS (10 ng/mL) but in the presence of rHusTRAIL-R2, TRAIL-induced TNF is suppressed.

Form

Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ESALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TMEM1  (5D5)
YF-MA15911 100 ug

Anti-TMEM1 (5D5)

Sign In for Pricing
View Details
Methyl 2,6-difluoro-3-sulfamoylbenzoate
TDC58091-01 100 mg

Methyl 2,6-difluoro-3-sulfamoylbenzoate

Sign In for Pricing
View Details
Methyl 2,6-difluoro-3-sulfamoylbenzoate
TDC58091-02 1 g

Methyl 2,6-difluoro-3-sulfamoylbenzoate

Sign In for Pricing
View Details
Anti-Zebrafish SLC4A1A Antibody Picoband® Fluoro550 Conjugated
AZQ7ZZJ7-Fluoro550 100 µg/Vial

Anti-Zebrafish SLC4A1A Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Rat/Human GABAa Receptor Gamma 2 (GAG2) Control/blocking peptide #1
GAG21-P 100 µg

Rat/Human GABAa Receptor Gamma 2 (GAG2) Control/blocking peptide #1

Sign In for Pricing
View Details
Superoxide Dismutase 4 (SOD-4) Antibody (3A1)
6171-100 100 µL

Superoxide Dismutase 4 (SOD-4) Antibody (3A1)

Sign In for Pricing
View Details