Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNR17 protein (Active)

This Human TNR17 protein (Active) spans the amino acid sequence from region 5-54aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

B-cell maturation protein

UniProt

Q02223

Expression Region

5-54aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit APRIL-mediated proliferation of anti-IgM stimulated murine B cells is no less than 40 ng/ml, corresponding to a specific activity of > 2.5 x 10 ^ 4 IU/mg in the presence of 100 ng/ml human APRIL.

Form

Lyophilized powder

Molecular Weight

5.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 30 % acetonitrile, 0.1 % TFA

AA Sequence

AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NDRG4 Antibody
MBS8242965-01 0.03 mL

Anti-NDRG4 Antibody

Sign In for Pricing
View Details
Anti-NDRG4 Antibody
MBS8242965-02 0.05 mL

Anti-NDRG4 Antibody

Sign In for Pricing
View Details
Anti-NDRG4 Antibody
MBS8242965-03 0.1 mL

Anti-NDRG4 Antibody

Sign In for Pricing
View Details
Anti-NDRG4 Antibody
MBS8242965-04 0.2 mL

Anti-NDRG4 Antibody

Sign In for Pricing
View Details
Anti-NDRG4 Antibody
MBS8242965-05 5x 0.2 mL

Anti-NDRG4 Antibody

Sign In for Pricing
View Details
Human SP110 siRNA
abx905215-01 15 nmol

Human SP110 siRNA

Sign In for Pricing
View Details