Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFA protein (Active)

This Human TNFA protein (Active) spans the amino acid sequence from region 87-233aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Cachectin, Tumor necrosis factor ligand superfamily member 2, TNF-a, , NTF

UniProt

P01375

Expression Region

87-233aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.01 ng/ml, corresponding to a specific activity of > 1.0 x 10^7 IU/mg in the presence of actinomycin D.

Form

Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.0

AA Sequence

MRKR+KPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLX3 Rabbit Polyclonal Antibody (PE-Cy5)
orb874694 100 µL

TLX3 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
CD55 (K142) polyclonal antibody
orb644299-01 25 µL

CD55 (K142) polyclonal antibody

Sign In for Pricing
View Details
CD55 (K142) polyclonal antibody
orb644299-02 50 μL

CD55 (K142) polyclonal antibody

Sign In for Pricing
View Details
CD55 (K142) polyclonal antibody
orb644299-03 100 µL

CD55 (K142) polyclonal antibody

Sign In for Pricing
View Details
CD55 (K142) polyclonal antibody
orb644299-04 200 µL

CD55 (K142) polyclonal antibody

Sign In for Pricing
View Details
1-{4-[ (Methoxycarbonyl) amino]benzenesulfonyl}pyrrolidine-2-carboxylic acid
IQB94647-01 50 mg

1-{4-[ (Methoxycarbonyl) amino]benzenesulfonyl}pyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details