What is the catalog number for Human TNR9 protein (Active)?

The catalog number for Human TNR9 protein (Active) is orb359190.

What sizes are available for Human TNR9 protein (Active)?

Human TNR9 protein (Active) is available in the following size(s): 5 µg, 100 µg, 500 µg.

How many pack sizes does Human TNR9 protein (Active) come in?

Human TNR9 protein (Active) is available in 3 different pack sizes.

Is Human TNR9 protein (Active) in stock?

Human TNR9 protein (Active) is currently made to order / not held in immediate stock. Contact us for lead time.

Human TNR9 protein (Active)

This Human TNR9 protein (Active) spans the amino acid sequence from region 19-184aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

4-1BB ligand receptor, T-cell antigen 4-1BB homolog, T-cell antigen ILA, CD antigen CD137

UniProt

Q07011

Expression Region

19-184aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity is determined by its inhibitory effect of IL-8 production using human peripheral blood mononuclear cells. About 90 % of inibition was seen using a concentration of 1 μg for both 4-1BB Ligand and 4-1BB Receptor.

Form

Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHS