Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NRN1 protein (Active)

This Human NRN1 protein (Active) spans the amino acid sequence from region 28-115aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

NRN

UniProt

Q9NPD7

Expression Region

28-115aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by by a cell proliferation assay using rat C6 cells is less than 25 ng/ml, corresponding to a specific activity of > 4.0 x 10 ^ 4 IU/mg.

Form

Lyophilized powder

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOR-1 rabbit pAb
ES6446-01 50 µL

MOR-1 rabbit pAb

Sign In for Pricing
View Details
MOR-1 rabbit pAb
ES6446-02 100 µL

MOR-1 rabbit pAb

Sign In for Pricing
View Details
Manganese carbonate
3123420 1 Each

Manganese carbonate

Sign In for Pricing
View Details
C2orf48 (NM_182626) Human Tagged ORF Clone Lentiviral Particle
RC210907L4V 200 µL

C2orf48 (NM_182626) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Chid1 sgRNA CRISPR Lentivector set (Rat)
K7418701 3x 1.0 µg

Chid1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
CB2 Antibody (C-term)
E45R11263G-4 50 µL

CB2 Antibody (C-term)

Sign In for Pricing
View Details